• Home
  • Prodotti
  • Cusabio
  • Recombinant Human respiratory syncytial virus A Fusion glycoprotein F0 (F), partial

Recombinant Human respiratory syncytial virus A Fusion glycoprotein F0 (F), partial

0 out of 0
0 recensione del cliente

362.00 EUR

Recombinant Human respiratory syncytial virus A Fusion glycoprotein F0 (F), partial
Recombinant Human respiratory syncytial virus A Fusion glycoprotein F0 (F), partial

Categoria di prodotto: Commercio e industria > Scienza e laboratorio

Catalog number: / Dimensione: / Prezzo: EUR (IVA esclusa)

Vai al carrello Vai all'ordine
Inquiry cart
1
Indirizzo Email: | Modifica
2
Dettagli dell'inchiesta
Recombinant Human respiratory syncytial virus A Fusion glycoprotein F0 (F), partial
Recombinant Human respiratory syncytial virus A Fusion glycoprotein F0 (F), partial

Catalog number: / Dimensione: / Prezzo: EUR (IVA esclusa)

3
Inquiry cart
Numero di catalogo: CSB-EP356041HPO-100ug

Categoria di prodotto: Commercio e industria > Scienza e laboratorio

Fornitore: Gentaur Taglia: 100ug

Prodotti relativi

Cusabio, CSB-EP319265HPWb1

Recombinant Human respiratory syncytial virus A Fusion glycoprotein F0 (F), partial

Cusabio, CSB-EP319265HPWb1-20ug

Recombinant Human respiratory syncytial virus A Fusion glycoprotein F0 (F), partial

Cusabio, CSB-EP356041HPO-20ug

Recombinant Human respiratory syncytial virus A Fusion glycoprotein F0 (F), partial

MyBiosource, MBS1196090-002mgYeast

Recombinant Human respiratory syncytial virus A Fusion glycoprotein F0 (F), partial

MyBiosource, MBS1072444-01mgYeast

Recombinant Human respiratory syncytial virus A Fusion glycoprotein F0 (F), partial


27-529aa



N-terminal 6xHis-B2M-tagged


Shipped on ice packs (+4°C). The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Repeated freezing and thawing should be avoided. Store working aliquots at 4°C for up to one week.


NITEEFYQSTCSAVSKGYLSALRTGWYTSVITIELSNIKENKCNGTDAKVKLIKQELDKYKNAVTELQLLMQSTPPTNNRARRELPRFMNYTLNNAKKTNVTLSKKRKRRFLGFLLGVGSAIASGVAVSKVLHLEGEVNKIKSALLSTNKAVVSLSNGVSVLTSKVLDLKNYIDKQLLPIVNKQSCSISNIETVIEFQQKNNRLLEITREFSVNAGVTTPVSTYMLTNSELLSLINDMPITNDQKKLMSNNVQIVRQQSYSIMSIIKEEVLAYVVQLPLYGVIDTPCWKLHTSPLCTTNTKEGSNICLTRTDRGWYCDNAGSVSFFPQAETCKVQSNRVFCDTMNSLTLPSEINLCNVDIFNPKYDCKIMTSKTDVSSSVITSLGAIVSCYGKTKCTASNKNRGIIKTFSNGCDYVSNKGMDTVSVGNTLYYVNKQEGKSLYVKGEPIINFYDPLVFPSDEFDASISQVNEKINQSLAFIRKSDELLHNVNAGKSTTNIMITT

For research use only.

0 recensione per Recombinant Human respiratory syncytial virus A Fusion glycoprotein F0 (F), partial

Aggiungi una recensione

12345

☆ ☆ ☆ ☆ ☆  (0)

SPEDIZIONE & RESO GRATUITI*

GARANZIA DI RIMBORSO

SUPPORTO ONLINE
ELK Biotech, ELK8275

ELISA kit for General CS (Chondroitin Sulfate)

Nova Lifetech, PVT10754

pCDNA3.1- EGFP

13361.00EUR 2ug
Zeptometrix, MDZ001

NATtrol RP Multimarker Control Pack (6 X 0.75 mL)

844.88EUR 6 X 0.75 mL
Micromod, 84-19-102

BNF-Dextranstreptavidin

465.00EUR 100nm
promozione-kit-citochine-elisa-Kit ELISA Citochine, sconto del 20% - CUSABIO

Acquista due o più kit ELISA per citochine, ottieni uno sconto del 20% – CUSABIO

Stai cercando kit ELISA per citochine di alto livello per far avanzare la tua ricerca? Non guardare oltre. Noi di CUSABIO siamo entusiasti di offrire una promozione esclusiva: acquista due o più kit ELISA per citochine e ottieni uno sconto del 20% sul tuo acquisto! Questa offerta a tempo limitato è progettata per fornire ai...

SuperKine™ West Pico PLUS Chemiluminescent Substrate

Abbkine ha lanciato una promozione per alcuni dei reagenti comunemente utilizzati in laboratorio e attualmente puoi usufruire dei vantaggi paghi uno prendi uno gratuiti per questi articoli. La promozione sarà valida fino al 30 giugno 2024. Non esitate a contattarci per ulteriori informazioni promozionali!SuperKine™ Serum/Protein-Free Cell Freezing MediumSuperKine™ Maximum Sensitivity Cell Counting Kit-8 (CCK-8)SuperKine™ Lipo3.0...

Printgraph – Sistema di documentazione di gel (SDG)

Gel Eye – Sistema di documentazione di gel (SDG) Gel Eye – Sistema di documentazione di Gel (SDG) Vantaggi del sistema Gel Eye: Un software intelligente GelView per scattare e analizzare le foto in tempo reale Meccanismo automatizzato di spegnere la luce UV che contribuisce alla sicurezza dell’utente. Detezione e analisi quantitativi della fluorescenza automatizzati...