SARS Coronavirus Envelope (HSZ-Cc) Recombinant Protein
Prodotti relativi
SARS Coronavirus Envelope (HSZ-Cc) Recombinant Protein
Store at -70 °C. Avoid repeated freeze-thaw cycles.
- Tested Applications: N/A
- Applications: N/A
- Predicted Molecular Weight: Mono-Isotopic Mass: 35, 162.15 daltons
- Average Mass: 35, 185.17 daltons
- Physical state: Liquid
- Buffer: 50 mM Tris-HCl pH 7.5, 270 mM Sucrose, 150 mM NaCl, 0.1 mM EGTA, 0.1 % 2-mercaptoethanol, 0.03 % Brij-35
- Concentration: batch dependent
- NCBI official symbol: E
- Accession #: NP_828854.1
- Protein GI: N/A
- NCBI gene ID#: 1489671
- NCBI official full name: Envelope small membrane protein
- NCBI organism: Severe acute respiratory syndrome coronavirus
- Peptide sequence: N/A
- SWISSPROT #: P59637
- Background Reference 1: N/A
- Background Reference 2: N/A
- Background Reference 3: N/A
- Background Reference 4: N/A
- Background Reference 5: N/A
- Source: bacteria
- Species: SARS
- By Source: Other
- By Species: Other
- Fusion tag: N-Term GST Uncleaved
- Sequence: Native Sequence:
- MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSMYSFVSEETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPTVYVYSRVKNLNSSEGVPDLLV
- Amino acids M1 – V76 (end).
- Residue M232 of the fusion protein is equivalent to M1 of the native enzyme. The GST tag is located at residues 1 – 220.
- Protease Cleavage:
- PreScission (LEVLFQGP) residues 221 - 228
- Biology activity: N/A
- Purity: GSH-Agarose (0.65)
Products are intended for laboratory research purposes only and should be used by qualified personnel only. They are not intended for use in humans. ProSci is not liable for damages or injuries resulting from receipt and/or use of ProSci materials. Please refer to the Material Safety Data Sheet (MSDS) for safe storage, handling, and use procedures.
Aggiungi una recensione
☆ ☆ ☆ ☆ ☆ (0)
0 recensione per SARS Coronavirus Envelope (HSZ-Cc) Recombinant Protein