[name]

UQCRFS1 Blocking Peptide

UQCRFS1 Blocking Peptide

180.00 EUR

Disponibilità: In ordine Numero di catalogo: 33R-6220 Fornitore: Fitzgerald Taglia: 100 ug


A synthetic peptide for use as a blocking control in assays to test for specificity of UQCRFS1 antibody, catalog no. 70R-5972



  • Storage: Store at -20°C long term. Avoid repeat freeze-thaw cycles.
  • Shipping InfoBlue Ice


  • Category: Blocking Peptides
  • Research Area: Proteases, Inhibitors, & Enzymes
  • Residues: MLSVASRSGPFAPVLSATSRGVAGALRPLVQATVPATPEQPVLDLKRPFL
  • Type: Synthetic
  • Form & Buffer: Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.
  • Applications: WB, IHC

0 recensione per UQCRFS1 Blocking Peptide


Aggiungi una recensione

12345

☆ ☆ ☆ ☆ ☆  (0)

Related Products:

Puntali con filtro PCR

Puntali con filtro PCR

Disponibile!Trovare il giusto puntale per pipettePuntali con filtro PCR (alta qualità) I nostri puntali filtranti per PCR sono progettati per adattarsi a quasi tutti i tipi di pipette. Sono prodotti con materiali di altissima qualità in un ambiente sterile, assicurando che siano privi di contaminanti che possono influenzare i tuoi risultati. Non tutte le punte [...]

LEPU Test Kit ELISA Anticorpi Neutralizzanti COVID-19

Metodo: ELISA Principio: Il reagente di rilevamento è realizzato con una tecnologia immunosoppressiva con anticorpi neutralizzanti. Il kit contiene il dominio di legame del recettore 2019-nCoV ricombinante marcato con perossidasi di rafano (RBD-HRP) e il recettore della cellula ospite ACE2 immobilizzato su piastra ELISA. Per informazioni scrivere a: [email protected] Manipolazione dei campioni Campioni: siero o [...]

LEPU Test Kit Anticorpi Neutralizzanti COVID-19 Immunocromatografia a Fluorescenza

Metodo: Immunocromatografia a Fluorescenza Principio: Il test contiene RBD e ACE2 etichettati fluorescenti, immobilizzati nell'area del test (T) e il corrispondente anticorpo nell'area del controllo qualità (C). Il kit è così composto: Kit anticorpi neutralizzanti Diluzione dei campioni Contagocce per campioni usa e getta.   Per informazioni scrivere a [email protected] Fasi operative: Interpretazione dei risultati: [...]

SPEDIZIONE & RESO GRATUITI*


GARANZIA DI RIMBORSO


SUPPORTO ONLINE