SHROOM2 Blocking Peptide

Produkt SHROOM2 Blocking Peptide

SHROOM2 Blocking Peptide

0.00 out of 0

180.00 EUR

A synthetic peptide for use as a blocking control in assays to test for specificity of SHROOM2 antibody, catalog no. 70R-5079
Disponibilità: In ordine Numero di catalogo: 33R-1824 Fornitore: Fitzgerald Taglia: 100 ug
Questo prodotto non ha una descrizione dettagliata. Contattaci per i dettagli su questo prodotto.
  • Category: Blocking Peptides
  • Research Area: Cell Biology
  • Residues: CTSPPGLSYMKAKEKTVEDLKSEELAREIVGKDKSLADILDPSVKIKTTM
  • Type: Synthetic
  • Form & Buffer: Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.
  • Applications: WB, IHC
  • Storage: Store at -20°C long term. Avoid repeat freeze-thaw cycles.
  • Shipping InfoBlue Ice

Related Products:

Metodo: ELISA Principio: Il reagente di rilevamento è realizzato con una tecnologia immunosoppressiva con anticorpi neutralizzanti. Il kit contiene il dominio di legame del recettore 2019-nCoV ricombinante marcato con perossidasi di rafano (RBD-HRP) e il recettore della cellula ospite ACE2 immobilizzato su piastra ELISA. Per informazioni scrivere a: [email protected] Manipolazione dei campioni Campioni: siero o [...]
Metodo: Immunocromatografia a Fluorescenza Principio: Il test contiene RBD e ACE2 etichettati fluorescenti, immobilizzati nell'area del test (T) e il corrispondente anticorpo nell'area del controllo qualità (C). Il kit è così composto: Kit anticorpi neutralizzanti Diluzione dei campioni Contagocce per campioni usa e getta.   Per informazioni scrivere a [email protected] Fasi operative: Interpretazione dei risultati: [...]
Metodo: Oro Colloidale Principio: il dispositivo contiene oro colloidale etichettato con la proteina Spike di COVID-19 (RBD); con anticorpo umano IgG immobilizzato nell'area G del test; anticorpo anti-topo umano IgM immobilizzato nell'area M del test e il corrispondente anticorpo nell'area di controllo qualità (C). ---> Testare tutti gli anticorpi IgG e IgM che possono legarsi con [...]

SPEDIZIONE & RESO GRATUITI*


GARANZIA DI RIMBORSO


SUPPORTO ONLINE