
SARS antibody
Prodotti relativi
Rabbit polyclonal SARS antibody raised against the C terminal of SARS
- Storage: Store at 2-8°C for short periods. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
- Shipping: Blue Ice
- Category: Purified Polyclonal Antibodies
- Research Area: DNA & RNA
- Immunogen: SARS antibody was raised using the C terminal of SARS corresponding to a region with amino acids PEKLKEFMPPGLQELIPFVKPAPIEQEPSKKQKKQHEGSKKKAAARDVTL
- Host: Rabbit
- Specificity: SARS antibody was raised against the C terminal of SARS
- Cross Reactivity: Human,Mouse,Rat,Dog
- Isotype: NA
- Clone: NA
- Method of Purification: Total IgG Protein A purified
- Concentration: 1 mg/ml
- Form & Buffer: Supplied as liquid, in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
- Applications: WB
- Usage Recommendations: WB: 1.25 ug/ml
Aggiungi una recensione
☆ ☆ ☆ ☆ ☆ (0)
0 recensione per SARS antibody