[name]

PDGFD antibody

PDGFD antibody

467.00 EUR

Disponibilità: In ordine Numero di catalogo: 70R-6220 Fornitore: Fitzgerald Taglia: 50 ug


Rabbit polyclonal PDGFD antibody raised against the N terminal of PDGFD



  • Storage: Store at 2-8°C for short periods. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
  • Shipping: Blue Ice


  • Category: Purified Polyclonal Antibodies
  • Research Area: Cytokines & Growth Factors
  • Immunogen: PDGFD antibody was raised using the N terminal of PDGFD corresponding to a region with amino acids NANLRRDESNHLTDLYRRDETIQVKGNGYVQSPRFPNSYPRNLLLTWRLH
  • Host: Rabbit
  • Specificity: PDGFD antibody was raised against the N terminal of PDGFD
  • Cross Reactivity: Human,Rat
  • Isotype: NA
  • Clone: NA
  • Method of Purification: Affinity purified
  • Concentration: 1 mg/ml
  • Form & Buffer: Supplied as liquid, in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  • Applications: WB
  • Usage Recommendations: WB: 1 ug/ml

0 recensione per PDGFD antibody


Aggiungi una recensione

12345

☆ ☆ ☆ ☆ ☆  (0)

Related Products:

Puntali con filtro PCR

Puntali con filtro PCR

Disponibile!Trovare il giusto puntale per pipettePuntali con filtro PCR (alta qualità) I nostri puntali filtranti per PCR sono progettati per adattarsi a quasi tutti i tipi di pipette. Sono prodotti con materiali di altissima qualità in un ambiente sterile, assicurando che siano privi di contaminanti che possono influenzare i tuoi risultati. Non tutte le punte [...]

LEPU Test Kit ELISA Anticorpi Neutralizzanti COVID-19

Metodo: ELISA Principio: Il reagente di rilevamento è realizzato con una tecnologia immunosoppressiva con anticorpi neutralizzanti. Il kit contiene il dominio di legame del recettore 2019-nCoV ricombinante marcato con perossidasi di rafano (RBD-HRP) e il recettore della cellula ospite ACE2 immobilizzato su piastra ELISA. Per informazioni scrivere a: [email protected] Manipolazione dei campioni Campioni: siero o [...]

LEPU Test Kit Anticorpi Neutralizzanti COVID-19 Immunocromatografia a Fluorescenza

Metodo: Immunocromatografia a Fluorescenza Principio: Il test contiene RBD e ACE2 etichettati fluorescenti, immobilizzati nell'area del test (T) e il corrispondente anticorpo nell'area del controllo qualità (C). Il kit è così composto: Kit anticorpi neutralizzanti Diluzione dei campioni Contagocce per campioni usa e getta.   Per informazioni scrivere a [email protected] Fasi operative: Interpretazione dei risultati: [...]

SPEDIZIONE & RESO GRATUITI*


GARANZIA DI RIMBORSO


SUPPORTO ONLINE