
LAB Blocking Peptide
Prodotti relativi
A synthetic peptide for use as a blocking control in assays to test for specificity of lab antibody, catalog no. 70R-2191
- Storage: Store at -20°C long term. Avoid repeat freeze-thaw cycles.
- Shipping InfoBlue Ice
- Category: Blocking Peptides
- Research Area: Differentiation & Development
- Residues: MMDVSSMYGNHPHHHHPHANAYDGYSTTTASAANASSYFAPQQHQPHLQL
- Type: Synthetic
- Form & Buffer: Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.
- Applications: WB, IHC
Aggiungi una recensione
☆ ☆ ☆ ☆ ☆ (0)
0 recensione per LAB Blocking Peptide