LAB antibody

549.19 EUR

Lorem ipsum asdokfopdskaf
LAB antibody
LAB antibody

Catalog number: / Dimensione: / Prezzo: EUR

Disponibilità: In ordine Numero di catalogo: 70R-2191 Fornitore: Fitzgerald Taglia: 50 ug

Rabbit polyclonal LAB antibody raised against the N terminal Of Lab

  • Storage: Store at 2-8°C for short periods. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
  • Shipping: Blue Ice

  • Category: Purified Polyclonal Antibodies
  • Research Area: Differentiation & Development
  • Immunogen: LAB antibody was raised using the N terminal Of Lab corresponding to a region with amino acids MMDVSSMYGNHPHHHHPHANAYDGYSTTTASAANASSYFAPQQHQPHLQL
  • Host: Rabbit
  • Specificity: LAB antibody was raised against the N terminal Of Lab
  • Cross Reactivity: Drosophila
  • Isotype: NA
  • Clone: NA
  • Method of Purification: Affinity purified
  • Concentration: 1 mg/ml
  • Form & Buffer: Supplied as liquid, in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  • Applications: WB, IHC
  • Usage Recommendations: WB: 1 ug/ml
  • IHC: 4-8 ug/ml

0 recensione per LAB antibody

Aggiungi una recensione


☆ ☆ ☆ ☆ ☆  (0)

Puntali con filtro PCR

Puntali con filtro PCR

Disponibile!Trovare il giusto puntale per pipettePuntali con filtro PCR (alta qualità) I nostri puntali filtranti per PCR sono progettati per adattarsi a quasi tutti i tipi di pipette. Sono prodotti con materiali di altissima qualità in un ambiente sterile, assicurando che siano privi di contaminanti che possono influenzare i tuoi risultati. Non tutte le punte [...]

LEPU Test Kit ELISA Anticorpi Neutralizzanti COVID-19

Metodo: ELISA Principio: Il reagente di rilevamento è realizzato con una tecnologia immunosoppressiva con anticorpi neutralizzanti. Il kit contiene il dominio di legame del recettore 2019-nCoV ricombinante marcato con perossidasi di rafano (RBD-HRP) e il recettore della cellula ospite ACE2 immobilizzato su piastra ELISA. Per informazioni scrivere a: [email protected] Manipolazione dei campioni Campioni: siero o [...]

LEPU Test Kit Anticorpi Neutralizzanti COVID-19 Immunocromatografia a Fluorescenza

Metodo: Immunocromatografia a Fluorescenza Principio: Il test contiene RBD e ACE2 etichettati fluorescenti, immobilizzati nell'area del test (T) e il corrispondente anticorpo nell'area del controllo qualità (C). Il kit è così composto: Kit anticorpi neutralizzanti Diluzione dei campioni Contagocce per campioni usa e getta.   Per informazioni scrivere a [email protected] Fasi operative: Interpretazione dei risultati: [...]