
LAB antibody
Prodotti relativi
Rabbit polyclonal LAB antibody raised against the N terminal Of Lab
- Storage: Store at 2-8°C for short periods. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
- Shipping: Blue Ice
- Category: Purified Polyclonal Antibodies
- Research Area: Differentiation & Development
- Immunogen: LAB antibody was raised using the N terminal Of Lab corresponding to a region with amino acids MMDVSSMYGNHPHHHHPHANAYDGYSTTTASAANASSYFAPQQHQPHLQL
- Host: Rabbit
- Specificity: LAB antibody was raised against the N terminal Of Lab
- Cross Reactivity: Drosophila
- Isotype: NA
- Clone: NA
- Method of Purification: Affinity purified
- Concentration: 1 mg/ml
- Form & Buffer: Supplied as liquid, in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
- Applications: WB, IHC
- Usage Recommendations: WB: 1 ug/ml
- IHC: 4-8 ug/ml
Aggiungi una recensione
☆ ☆ ☆ ☆ ☆ (0)
0 recensione per LAB antibody