Glycoprotein Ib antibody

Produkt Glycoprotein Ib antibody

Glycoprotein Ib antibody

0.00 out of 0

467.00 EUR

Rabbit polyclonal Glycoprotein Ib antibody
Disponibilità: In ordine Numero di catalogo: 70R-6193 Fornitore: Fitzgerald Taglia: 50 ug
Questo prodotto non ha una descrizione dettagliata. Contattaci per i dettagli su questo prodotto.
  • Category: Purified Polyclonal Antibodies
  • Research Area: Cell Biology
  • Immunogen: Glycoprotein Ib antibody was raised using a synthetic peptide corresponding to a region with amino acids RGSLPTFRSSLFLWVRPNGRVGPLVAGRRPSALSQGRGQDLLSTVSIRYS
  • Host: Rabbit
  • Specificity: NA
  • Cross Reactivity: Human
  • Isotype: NA
  • Clone: NA
  • Method of Purification: Affinity purified
  • Concentration: 1 mg/ml
  • Form & Buffer: Supplied as liquid, in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  • Applications: WB
  • Usage Recommendations: WB: 0.25 ug/ml
  • Storage: Store at 2-8°C for short periods. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
  • Shipping: Blue Ice

Related Products:

Metodo: ELISA Principio: Il reagente di rilevamento è realizzato con una tecnologia immunosoppressiva con anticorpi neutralizzanti. Il kit contiene il dominio di legame del recettore 2019-nCoV ricombinante marcato con perossidasi di rafano (RBD-HRP) e il recettore della cellula ospite ACE2 immobilizzato su piastra ELISA. Per informazioni scrivere a: [email protected] Manipolazione dei campioni Campioni: siero o [...]
Metodo: Immunocromatografia a Fluorescenza Principio: Il test contiene RBD e ACE2 etichettati fluorescenti, immobilizzati nell'area del test (T) e il corrispondente anticorpo nell'area del controllo qualità (C). Il kit è così composto: Kit anticorpi neutralizzanti Diluzione dei campioni Contagocce per campioni usa e getta.   Per informazioni scrivere a [email protected] Fasi operative: Interpretazione dei risultati: [...]
Metodo: Oro Colloidale Principio: il dispositivo contiene oro colloidale etichettato con la proteina Spike di COVID-19 (RBD); con anticorpo umano IgG immobilizzato nell'area G del test; anticorpo anti-topo umano IgM immobilizzato nell'area M del test e il corrispondente anticorpo nell'area di controllo qualità (C). ---> Testare tutti gli anticorpi IgG e IgM che possono legarsi con [...]