Anti-TUB 1 Antibody

352.80 EUR

Disponibilità: In ordine Numero di catalogo: A02917-1 Fornitore: BosterBio Taglia: 100ug/vial


  • Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.
  • Shipping Condition: Shipped with wet ice


  • Clonality: Polyclonal
  • Ig type: Rabbit IgG
  • Form: Lyophilized
  • Specificity: No cross reactivity with other proteins.
  • Reactivity: Reacts with: human
  • Application: WB,FCM
  • Notes: Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.
  • Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human TUB 1 (395-429aa VHERVSIRPRNEHETLLARWQNKNTESIIELQNKT), different from the related mouse and rat sequences by one amino acid.
  • Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
  • Purification: Immunogen affinity purified.
  • ReconstitutionAdd 0.2ml of distilled water will yield a concentration of 500ug/ml.
  • Gene Name: TUB
  • Protein Name: Tubby protein homolog
  • Gene Full Name: tubby bipartite transcription factor
  • Uniprot ID: P50607
  • Entrez GeneID: 7275

0 recensione per Anti-TUB 1 Antibody


Aggiungi una recensione

12345

☆ ☆ ☆ ☆ ☆  (0)

Puntali con filtro PCR

Puntali con filtro PCR

Disponibile!Trovare il giusto puntale per pipettePuntali con filtro PCR (alta qualità) I nostri puntali filtranti per PCR sono progettati per adattarsi a quasi tutti i tipi di pipette. Sono prodotti con materiali di altissima qualità in un ambiente sterile, assicurando che siano privi di contaminanti che possono influenzare i tuoi risultati. Non tutte le punte [...]

LEPU Test Kit ELISA Anticorpi Neutralizzanti COVID-19

Metodo: ELISA Principio: Il reagente di rilevamento è realizzato con una tecnologia immunosoppressiva con anticorpi neutralizzanti. Il kit contiene il dominio di legame del recettore 2019-nCoV ricombinante marcato con perossidasi di rafano (RBD-HRP) e il recettore della cellula ospite ACE2 immobilizzato su piastra ELISA. Per informazioni scrivere a: [email protected] Manipolazione dei campioni Campioni: siero o [...]

LEPU Test Kit Anticorpi Neutralizzanti COVID-19 Immunocromatografia a Fluorescenza

Metodo: Immunocromatografia a Fluorescenza Principio: Il test contiene RBD e ACE2 etichettati fluorescenti, immobilizzati nell'area del test (T) e il corrispondente anticorpo nell'area del controllo qualità (C). Il kit è così composto: Kit anticorpi neutralizzanti Diluzione dei campioni Contagocce per campioni usa e getta.   Per informazioni scrivere a [email protected] Fasi operative: Interpretazione dei risultati: [...]

SPEDIZIONE & RESO GRATUITI*


GARANZIA DI RIMBORSO


SUPPORTO ONLINE